Protein Info for PP_0557 in Pseudomonas putida KT2440

Annotation: Acetoin catabolism regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 PF01590: GAF" amino acids 77 to 207 (131 residues), 39.8 bits, see alignment E=1.3e-13 PF00158: Sigma54_activat" amino acids 315 to 477 (163 residues), 220.5 bits, see alignment E=2.2e-69 PF14532: Sigma54_activ_2" amino acids 318 to 484 (167 residues), 84.9 bits, see alignment E=1.3e-27 PF02954: HTH_8" amino acids 573 to 605 (33 residues), 30.4 bits, see alignment (E = 5.3e-11)

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0557)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QD7 at UniProt or InterPro

Protein Sequence (617 amino acids)

>PP_0557 Acetoin catabolism regulatory protein (Pseudomonas putida KT2440)
MLAANSRAHVDCVSRVLKNADRLPQAPVPPLILDSWRRSMDVYRLDPGSQQGPRILSQSL
LNECRERAELFLRIASDAVARLHERVRGADYCVLLTDAQGRTIDYRVESAIRNDCRKAGL
YLGTCWSEGEEGTCGVAAVLTSKAPVTVHKRDHFRAAFIGLTCTAAPVFDPLGELLGVVD
VSALQSPDDRRSQHLIRQLVEQTAREIENAFFMHSAQGHWVMRAHGTPGYVESQPDYLLA
WDADGRLQAINSLARQRLVERLGRLPEHIGELFDIDQLRRVSASSAQRLPGLGGLYGRVS
APQQRQRAQPLRQAQDTRIEQHLRLATRVKDCNLAVLVLGETGAGKEVFARQLHQQSQRC
DGPFVTLNCAAIPESLIESELFGYVAGAFTGASSKGMQGLLQQADGGTLFLDEIGDMPLN
LQTRLLRVLAEGEVAPLGAARRERVDIQVICATHRDLAAMVEDGRFREDLYFRLANARFE
LPPLRERDDRLGLIHQLLAEEAAACGVEVVLADDALQALLVYRWPGNLRQLRQVLRYACA
VSEGGQVRLQDLPQEVRGEAVGSAESGVSCPARQLLLDALIRHRWKPADAARALGISRAT
LYRRVHEHRIDMPRMKG