Protein Info for PP_0546 in Pseudomonas putida KT2440

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 PF01590: GAF" amino acids 71 to 202 (132 residues), 43.4 bits, see alignment E=1.7e-14 PF13426: PAS_9" amino acids 240 to 288 (49 residues), 27 bits, see alignment 1.6e-09 PF00158: Sigma54_activat" amino acids 336 to 497 (162 residues), 210.9 bits, see alignment E=3.5e-66 PF14532: Sigma54_activ_2" amino acids 350 to 501 (152 residues), 66.5 bits, see alignment E=1.1e-21 PF07728: AAA_5" amino acids 354 to 460 (107 residues), 25 bits, see alignment E=6e-09 PF02954: HTH_8" amino acids 627 to 665 (39 residues), 49.6 bits, see alignment 9.1e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0546)

Predicted SEED Role

"sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QE8 at UniProt or InterPro

Protein Sequence (671 amino acids)

>PP_0546 sigma-54 dependent transcriptional regulator (Pseudomonas putida KT2440)
MQSNHFTRHARQVHSVAHGGAGEGGSDPSIARSWLRCLEDYHLDPAVIEAPVVLEHGRLL
ESRERLHQVLQIADHEMNSLHQQLSGAGHAVLLTDARGVILNCVSAPAERRSFERAGLWL
GADWSEAREGTNGIGTCLVERQALTIHQNEHFRGRHTGLTCSASPVFDPHGDLLAVLDVS
SARPDVSRQSQFHTMALVNLSAKMIESCYFLRHFEQQWLLRFHLQAESVGLFSEGLLAFD
GDGRICAANQSALNLLGTVRGGVLGKPLECFFACSHDEMFSRATPGGSAVWPLRTLDGRQ
VFASLRGQARAPVWSVPAAQPRPAGEVEPLVCLLDPALQNDFRRSVRVFERDVPLLLRGE
TGCGKEAFAQAVHQASERRGKPFVAINCASIPESLIESELFGYRGGSFTGARKEGMRGKL
LQADGGTLLLDEIGDMPLALQTRLLRVLEERQVVPIGGEPQAVDVRIVSATHRDLLERVE
QGSFREDLYYRLNGLEVALPAVRERSDKAQLLDFLLRQETQGQWIDIEPRARQALLAFNW
PGNVRQMRNVLRTLVALCEDARITFADLPAVIRTSPPLAGVGEPAKMSDQEMEGEGVALV
RGQARSHRSGGAAEIEGESAGTEVLLDAERQALKEVLEAKHWHLTRVAEHLGISRNTLYR
KLRKHGITRGD