Protein Info for PP_0534 in Pseudomonas putida KT2440

Annotation: putative Transcriptional regulator PfeR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00072: Response_reg" amino acids 6 to 113 (108 residues), 89 bits, see alignment E=2.3e-29

Best Hits

Swiss-Prot: 30% identical to HSSR_STAEQ: Heme response regulator HssR (hssR) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0534)

Predicted SEED Role

"Two-component response regulator PfeR, enterobactin" in subsystem Siderophore Enterobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QG0 at UniProt or InterPro

Protein Sequence (230 amino acids)

>PP_0534 putative Transcriptional regulator PfeR (Pseudomonas putida KT2440)
MPTSLLLAEDDPRLLQDLDRHFRNRGFLVHACASGTQALNAIQQSQFELVLLDIMLPGID
GLSLLDALRRQQAVPVMLMSALGAEQDRISGFTRGADDYLPKPFSLAELDARVDALLRRV
AFDRGTALRADVGEVMLDHDRQDVIHNGNAAGLTASEFRLLVTLLAHPDEALSKPFLYQT
VLHRAYTRLDRGLDVHVCNLRRKLADINAQHLQIQAVRGQGYILVDTEQA