Protein Info for PP_0527 in Pseudomonas putida KT2440

Annotation: 1-deoxyxylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 18 to 289 (272 residues), 402.6 bits, E=2.1e-124
• TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase
  • amino acids 22 to 626 (605 residues), 884.2 bits, E=2.5e-270
• PF00676: E1_dh
  • amino acids 131 to 193 (63 residues), 26.1 bits, E=1e-09
• PF02775: TPP_enzyme_C
  • amino acids 133 to 190 (58 residues), 25.4 bits, 2.8e-09
• PF02779: Transket_pyr
  • amino acids 326 to 486 (161 residues), 150.5 bits, E=9.5e-48
• PF02780: Transketolase_C
  • amino acids 502 to 618 (117 residues), 94.3 bits, E=1.3e-30

Best Hits

Swiss-Prot: 100% identical to DXS_PSEPK: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to ppu:PP_0527)

MetaCyc: 62% identical to 1-deoxy-D-xylulose-5-phosphate synthase (Escherichia coli K-12 substr. MG1655)
1-deoxy-D-xylulose-5-phosphate synthase. [EC: 2.2.1.7]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• methylerythritol phosphate pathway II (8/9 steps found)
• isoprene biosynthesis I (8/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (8/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (4/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

See Q88QG7 at UniProt or InterPro

Protein Sequence (631 amino acids)

>PP_0527 1-deoxyxylulose-5-phosphate synthase (Pseudomonas putida KT2440)
MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQELLYTVGQTGGHFGAG
LGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRMLSLRQKDGIAAFPRRSES
EYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDGALTAGMAFEALNHAQEVNAD
MLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREGSKKVLSRLPGAWEIARRTEEYA
KGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNMRDLKGPQFLHVVTKKGKGFAPAEI
DPIGYHAITKLEPADKPAAPKKASGPKYSAVFGQWLCDMAAADNRLVGITPAMKEGSDLV
DFSERYPERYFDVAIAEQHAVTLAAGMACEGSKPVVAIYSTFLQRAYDQLIHDVAVQNLD
VLFAIDRAGLVGEDGPTHAGSYDLSYLRCIPGMLVMTPSDENELRKMLSTGHLYNGPAAV
RYPRGTGPNAPISGDLQPLEIGKGVVRRQGEKVALLVFGVQLAEAMQVAEQINATVVDMR
FVKPLDEALVLELAGSHELLVTIEENAIMGGAGAAVGEFLASQAVLKPLLHLGLPDIYVE
HAKPAQMLAECGLDAAGIEASVKARMARLGL