Protein Info for PP_0524 in Pseudomonas putida KT2440

Annotation: putative Periplasmic cobalamin-binding protein HutB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 23 to 240 (218 residues), 87.4 bits, see alignment E=5e-29

Best Hits

Swiss-Prot: 32% identical to BTUF_VIBCH: Vitamin B12-binding protein (btuF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to ppu:PP_0524)

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QG9 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PP_0524 putative Periplasmic cobalamin-binding protein HutB (Pseudomonas putida KT2440)
MRLLPGLLALFACTVLAAEPLRVVSLAPSMSEIMLELQADDLLVGVLDGGERPAALRHLP
SVGRQGQLDMERLLSLRPDLLLLWPGSVPPAQRDQLKRLGIATFSAEPHDISQLIEQIEA
IAERVGRAKQGHSYARALRERLQQLRQQYRRDEPLQVFYQVWDRPLYTLGGRQVVTDALA
VCGARNVFADLGQPAPQVNVESVLLRNPQVILAADEAQLASWKAWPQIRAVADGRLLVVP
DKGLERPSGQMIEATARLCALLDAKAPVSR