Protein Info for PP_0520 in Pseudomonas putida KT2440

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 59 to 80 (22 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details PF04608: PgpA" amino acids 25 to 162 (138 residues), 152.8 bits, see alignment E=3e-49

Best Hits

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 99% identity to ppf:Pput_0555)

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QH3 at UniProt or InterPro

Protein Sequence (167 amino acids)

>PP_0520 phosphatidylglycerophosphatase A (Pseudomonas putida KT2440)
MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSLVAIPFIPLWQLLPDWG
YWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWITLWLVPEGWQWLLAGFLMF
RFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQVLVWAVA