Protein Info for PP_0503 in Pseudomonas putida KT2440

Annotation: Major facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 322 (308 residues), 101.9 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 34% identical to YDER_BACSU: Uncharacterized MFS-type transporter YdeR (ydeR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0503)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QI9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PP_0503 Major facilitator family transporter (Pseudomonas putida KT2440)
MTPSLTRWITLLLATTSAMAVATVYFAQPLLESMAAELGVAQQQIGWVVGATQAGYALGL
LLIVPLGDLVDRKRLLLGQLLFAALALVGVGMAPNWAILLLALAITGLMAVMVQVMVAHA
ASLASPGQQGQAVGTVTSGVVLGILLARLASGGLADLAGWRSVYLASAGLLMLLALVLWR
SLPGGQPMGIRPGYRALIVAQFSLYRHDRLLRQRGVFGVLIFAAFSVLWSAMVMPLSAAP
LTLSHTEIGLFGLAGVAGTLAASHAGRLADLGRGECTTGVSLALLTLSWLPTAFVEHSLL
AFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASRLIGAYMCCYSLGSGLGAVLASWVFAH
WGWVAVCGLGMGISAAALCYWLWLQRARAAEAALQCSGQNL