Protein Info for PP_0493 in Pseudomonas putida KT2440

Annotation: selenocysteine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 PF12390: Se-cys_synth_N" amino acids 11 to 48 (38 residues), 45.4 bits, see alignment 7e-16 TIGR00474: L-seryl-tRNA(Sec) selenium transferase" amino acids 11 to 461 (451 residues), 599.8 bits, see alignment E=1.8e-184 PF03841: SelA" amino acids 85 to 456 (372 residues), 563.7 bits, see alignment E=1.8e-173

Best Hits

Swiss-Prot: 100% identical to SELA_PSEPK: L-seryl-tRNA(Sec) selenium transferase (selA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01042, L-seryl-tRNA(Ser) seleniumtransferase [EC: 2.9.1.1] (inferred from 100% identity to ppu:PP_0493)

Predicted SEED Role

"L-seryl-tRNA(Sec) selenium transferase (EC 2.9.1.1)" in subsystem Selenocysteine metabolism (EC 2.9.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QJ8 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PP_0493 selenocysteine synthase (Pseudomonas putida KT2440)
MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLLDDLREPARNGELGSAE
LAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALLPDEAIEAMQTAARYPLNL
EFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLALNSLGARKEGIISRGELI
EIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIGPRTGLLMRVHCSNYSIQGFTTQ
VPTAELARIAHQHELPLLEDLGSGSLLDLTRWGLPAEPTVRQALADGADIVTFSGDKLLG
GPQAGIIVGHKDLITRIKKNPLKRALRVDKITLAALEAVLALYRNPDRLAERLPSLRLLT
RSQAEIQAQAERLAPELQARLGEQWAISVEPALGMIGSGSQPVARLPSAALCLRPQVSKK
LRGRSLHVLERALRDLPVPVLGRIDDDALWLDLRQLDDEAQWLAQLPALQLGPVQ