Protein Info for PP_0492 in Pseudomonas putida KT2440

Annotation: formate dehydrogenase formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 14 to 315 (302 residues), 351.5 bits, see alignment E=2.5e-109 PF04216: FdhE_N" amino acids 27 to 188 (162 residues), 168.7 bits, see alignment E=2.2e-53 PF24859: FdhE_central" amino acids 194 to 231 (38 residues), 62.9 bits, see alignment 3.6e-21 PF24860: FdhE_C" amino acids 232 to 313 (82 residues), 101.3 bits, see alignment E=4.2e-33

Best Hits

Swiss-Prot: 100% identical to FDHE_PSEPK: Protein FdhE homolog (fdhE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to ppu:PP_0492)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QJ9 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PP_0492 formate dehydrogenase formation protein (Pseudomonas putida KT2440)
MITDEKKDERLSIILEPGQIEASAVTPPFLHLPAANLFELRAARLEQLAEGNALGDYLRL
IARLCRIQQQLVDNPPGGMPVAEARQRLCMDHGLPPLAADSLVREGPWLVWLQALLEHLS
GETRGPMGEALQVLRGSDDNQRKGWGIALLAGQYDGVPAALVPFLGAALQAAWSSWLLAL
PAHQLKPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWHVVRVKCVYCESS
KDLRYTSLEDDRHAPGKAPLRAECCPGCDSYLKQNYLENDAAAEPLADDLASLALDIRLD
GEGFHRLAPNLMLAPGGG