Protein Info for PP_0490 in Pseudomonas putida KT2440

Annotation: formate dehydrogenase-O, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 5 to 284 (280 residues), 455.4 bits, E=3.2e-141
• PF12838: Fer4_7
  • amino acids 33 to 110 (78 residues), 38.5 bits, E=6.7e-13
• PF13247: Fer4_11
  • amino acids 88 to 184 (97 residues), 87.9 bits, E=2.2e-28
• PF13237: Fer4_10
  • amino acids 90 to 140 (51 residues), 28.1 bits, 8e-10
• PF12837: Fer4_6
  • amino acids 121 to 143 (23 residues), 24.1 bits, see alignment (E = 1.3e-08)
• PF00037: Fer4
  • amino acids 123 to 143 (21 residues), 25.8 bits, see alignment (E = 3.4e-09)
• PF09163: Form-deh_trans
  • amino acids 242 to 285 (44 residues), 78.7 bits, 1.1e-25

Best Hits

Swiss-Prot: 67% identical to FDOH_ECOLI: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Escherichia coli (strain K12)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to ppf:Pput_0524)

MetaCyc: 67% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

No annotation

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (1/2 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• nitrate reduction III (dissimilatory) (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

See Q88QK1 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PP_0490 formate dehydrogenase-O, beta subunit (Pseudomonas putida KT2440)
MASQDIIARSATTTVPPSVRQQEEVAKLIDTTKCIGCKACQVACSEWNELRDEVGHNHGT
YDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADPGCLKACPSPGAIIKHANG
IVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCSDRVSVGLEPACVKTCPTGAI
VFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGTHVMYVLHHADTPKLYAGLPDQP
VISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRIGPQRVEEDEHPTPPDESVHQVDPSV
HVYDPKQPGGQGEQRP