Protein Info for PP_0484 in Pseudomonas putida KT2440

Annotation: transporter of an unknown substrate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 284 to 300 (17 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 358 (339 residues), 147.8 bits, see alignment E=5.8e-47 amino acids 282 to 397 (116 residues), 42.2 bits, see alignment E=7.9e-15 PF00083: Sugar_tr" amino acids 50 to 136 (87 residues), 32.1 bits, see alignment E=9.1e-12 PF21987: YajR_YAM" amino acids 401 to 455 (55 residues), 47.1 bits, see alignment 2.5e-16

Best Hits

Swiss-Prot: 54% identical to YAJR_ECOLI: Inner membrane transport protein YajR (yajR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0484)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QK6 at UniProt or InterPro

Protein Sequence (464 amino acids)

>PP_0484 transporter of an unknown substrate (Pseudomonas putida KT2440)
MHDTHNERMSGGETRAAGGLALVFAFRMLGMFMVLPVLATYGMDLAGATPALIGLAIGAY
GLTQAVLQIPFGMISDRIGRRPVIYLGLVIFALGSVLAAQADSIWGVIAGRILQGAGAIS
AAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPLLTSAFGLSGLFLVTAGLALV
GILLIAFVVPSTHSILQHRESGVARQAIGPTLRHPDLLRLDVSIFILHAVLMASFVALPL
AFVERGGLPKEQHWWVYLTALFISFFAMVPFIIYGEKKRKMKRVLAGAVSVLLLTEIYFW
EWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKVSPAGGKGTAMGVYSTSQFLGAALGGI
LGGWLFQHGGLNTVFLGSAVLCAIWLIVALRMNEPPYVTSLRMPLTPEAVREAGLTERLM
AVPGVTDAVVVEEEAAIYIKLDTKILDRATLERLVNPASSACEA