Protein Info for PP_0471 in Pseudomonas putida KT2440

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 11 to 164 (154 residues), 213.1 bits, E=9.2e-68
• PF00333: Ribosomal_S5
  • amino acids 14 to 75 (62 residues), 96.7 bits, E=6.6e-32
• PF03719: Ribosomal_S5_C
  • amino acids 90 to 158 (69 residues), 108.9 bits, E=6.7e-36

Best Hits

Swiss-Prot: 100% identical to RS5_PSEPW: 30S ribosomal protein S5 (rpsE) from Pseudomonas putida (strain W619)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 99% identity to pen:PSEEN0507)

MetaCyc: 78% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

See Q88QL8 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PP_0471 30S ribosomal protein S5 (Pseudomonas putida KT2440)
MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKGRVGFGRGKSREVPAA
IQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGTGIIAGGAMRAVLEVAG
VQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGKSVEEIF