Protein Info for PP_0449 in Pseudomonas putida KT2440

Annotation: 30S ribosomal protein S12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00981: ribosomal protein uS12
  • amino acids 1 to 123 (123 residues), 228.3 bits, E=8.4e-73
• PF00164: Ribosom_S12_S23
  • amino acids 12 to 123 (112 residues), 141.8 bits, E=3.4e-46

Best Hits

Swiss-Prot: 100% identical to RS12_PSEP1: 30S ribosomal protein S12 (rpsL) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K02950, small subunit ribosomal protein S12 (inferred from 98% identity to psb:Psyr_4553)

MetaCyc: 86% identical to 30S ribosomal subunit protein S12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S12p (S23e)" in subsystem Ribosomal protein S12p Asp methylthiotransferase or Ribosome SSU bacterial

Sequence Analysis Tools

See Q88QP0 at UniProt or InterPro

Protein Sequence (123 amino acids)

>PP_0449 30S ribosomal protein S12 (Pseudomonas putida KT2440)
MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNG
FEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKGRNQGRSKYGTK
RPK