Protein Info for PP_0442 in Pseudomonas putida KT2440

Annotation: transcription antipausing factor NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 PF02357: NusG" amino acids 3 to 107 (105 residues), 106.4 bits, see alignment E=9.1e-35 TIGR00922: transcription termination/antitermination factor NusG" amino acids 5 to 177 (173 residues), 225.7 bits, see alignment E=1.6e-71 PF00467: KOW" amino acids 126 to 156 (31 residues), 31.6 bits, see alignment 1e-11

Best Hits

Swiss-Prot: 95% identical to NUSG_PSEAE: Transcription termination/antitermination protein NusG (nusG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 97% identity to pfo:Pfl01_5091)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QP6 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PP_0442 transcription antipausing factor NusG (Pseudomonas putida KT2440)
MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEEVVEMRNGQKRKSERKF
FPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDKEAEAILRRVADGSDKPKP
KTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLIFGRSTPVELEFSQVEKV