Protein Info for PP_0438 in Pseudomonas putida KT2440

Annotation: Type III pantothenate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03309: Pan_kinase
  • amino acids 2 to 200 (199 residues), 142.7 bits, E=7.1e-46
• TIGR00671: pantothenate kinase, type III
  • amino acids 5 to 243 (239 residues), 90.2 bits, E=8.9e-30

Best Hits

Swiss-Prot: 100% identical to COAX_PSEPK: Type III pantothenate kinase (coaX) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to ppu:PP_0438)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• phosphopantothenate biosynthesis II (1/3 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

See Q88QQ0 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PP_0438 Type III pantothenate kinase (Pseudomonas putida KT2440)
MILELDCGNSFIKWRVIHVADAVIEGGGIVDSDQALVAEVAALASVRLTGCRIVSVRSEE
ETDALCALIAQAFAVQAKVAHPVREMAGVRNGYDDYQRLGMDRWLAALGAFHLAKGACLV
IDLGTAAKADFVSADGEHLGGYICPGMPLMRSQLRTHTRRIRYDDASAERALSSLSPGRS
TVEAVERGCVLMLQGFAYTQLEQARVLWGEEFTVFLTGGDAPLVRAALPQARVVPDLVFV
GLAMACPLD