Protein Info for PP_0427 in Pseudomonas putida KT2440

Annotation: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 114 to 133 (20 residues), see Phobius details PF03232: COQ7" amino acids 52 to 210 (159 residues), 146.6 bits, see alignment E=5.8e-47 PF02915: Rubrerythrin" amino acids 61 to 186 (126 residues), 33.5 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 100% identical to COQ7_PSEPK: 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (coq7) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06134, ubiquinone biosynthesis monooxygenase Coq7 [EC: 1.14.13.-] (inferred from 98% identity to ppg:PputGB1_0457)

MetaCyc: 82% identical to 5-demethoxyubiquinol hydroxylase (Pseudomonas aeruginosa)
RXN-9243 [EC: 1.14.99.60]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.99.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QR1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PP_0427 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (Pseudomonas putida KT2440)
MATERHYSPLDRLLLQADTAMRTLLPFSGQPTRPSPAIVQPDADLDEQQARHIAGLMRIN
HTGEVCAQALYQGQALTAKLPEVRKAMEHAAEEEVDHLAWCEQRIRQLNSHPSVLNPLFY
GMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQLPHEDEKSRAILEQMRIDEEQ
HAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI