Protein Info for PP_0400 in Pseudomonas putida KT2440

Annotation: CO2+/MG2+ efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 PF04379: DUF525" amino acids 19 to 102 (84 residues), 118 bits, see alignment E=8.8e-39

Best Hits

Swiss-Prot: 100% identical to APAG_PSEP1: Protein ApaG (apaG) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K06195, ApaG protein (inferred from 99% identity to ppg:PputGB1_0431)

Predicted SEED Role

"ApaG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QT7 at UniProt or InterPro

Protein Sequence (126 amino acids)

>PP_0400 CO2+/MG2+ efflux protein (Pseudomonas putida KT2440)
MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSAKLLSRHWLITNGDGEV
EEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFAEDGKRFDAEIAPFRLA
VPGALH