Protein Info for PP_0395 in Pseudomonas putida KT2440

Annotation: putative type IV piliation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 PF04293: SpoVR" amino acids 16 to 434 (419 residues), 611.6 bits, see alignment E=5.9e-188 PF24755: YcgB" amino acids 438 to 489 (52 residues), 91.7 bits, see alignment 2.2e-30

Best Hits

Swiss-Prot: 68% identical to YCGB_ECOLI: Uncharacterized protein YcgB (ycgB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0429)

Predicted SEED Role

"FIG004684: SpoVR-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QU1 at UniProt or InterPro

Protein Sequence (522 amino acids)

>PP_0395 putative type IV piliation protein (Pseudomonas putida KT2440)
MTARAQRRQPISTGSEWTFELIQTYDREISRLAERYALDTYPNQIEVITAEQMMDAYASV
GMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIAYLMEENTMCMQALVIAHA
CYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEERHGIDAVEDLIDSCHALMNYG
VDRYKRPYPISAEEERRRQQEREEHLQRQINDLWRTIPKNAEKGNDRDEGRFPAEPQENI
LYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQVMNEGWATFWHYTLMNDLYDEGLI
TEGFMMEFLQSHTSVVFQPGFDSPYYSGINPYALGFAMYTDIRRMCENPTEEDRHWFPEI
AGSDWLSTIKFAMSSFKDESFILQYLSPKVMRDLKLFSILDDDQRDDLLVPAIHDEAGYR
VIREQLAAQYNLGNREPNVQIWSVDRRGDRSLTLRHQQHNRKPLGDSTDEVLKHLHRLWG
FDIHLETVQGEQVMSTHHMPPRGEHSESADYGRMDLAVIHHL