Protein Info for PP_0381 in Pseudomonas putida KT2440

Annotation: Coenzyme PQQ synthesis protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 766 TIGR02110: coenzyme PQQ biosynthesis protein PqqF" amino acids 6 to 675 (670 residues), 575 bits, see alignment E=1.5e-176 PF00675: Peptidase_M16" amino acids 19 to 142 (124 residues), 81.3 bits, see alignment E=1.4e-26 PF22455: PqqF_C_3" amino acids 421 to 553 (133 residues), 57.2 bits, see alignment E=3.6e-19 PF05193: Peptidase_M16_C" amino acids 606 to 680 (75 residues), 25.5 bits, see alignment E=2.3e-09 PF22456: PqqF-like_C_4" amino acids 617 to 679 (63 residues), 65.2 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 100% identical to PQQF_PSEPK: Coenzyme PQQ synthesis protein F (pqqF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0381)

Predicted SEED Role

"Coenzyme PQQ synthesis protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QV3 at UniProt or InterPro

Protein Sequence (766 amino acids)

>PP_0381 Coenzyme PQQ synthesis protein F (Pseudomonas putida KT2440)
MPDAIRQLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPAKWPGLAHFLEHLFFLGTP
RFPLEDGLMRYVQALGGQVNASTRERATDFFFEVPPNALGGGLERLCQMLAEPDLGIERQ
RREREVIHAEFIAWSRNPTAQQQFALLQSVSARHPLGAFHAGNRYTLALHDAAFQQALAG
FHQRFYQGGQICLSLCGPQPLDELERLARQQAELFAAGERVPQILPPPLPAMASALTFTH
QSLPSGAEHALELLIAYLEDSRPGTWLGALRERGWLRRFTAERLYAFAGQLLWHLDLKLS
ADACPDEASALLQGWFRFIRQADREQLNHQFGLLQHSRAHSASALELARRDSTGQPFAKL
DTQGLQALGALLESLPGADHGDWQLLPVDPLLKADLPHAKAQPLPAALKISDQLPPARQF
AALYLRWHVPSPMRQPLQRVLEQALAPLQERCDRASVQLQYSSAGEYWQLHCAGLPAAVL
RAVEQALALMLKPPASCWLPCTALPPALIPIRALLKQLPDAVRGSLPPAVPACTLTQQQL
DSLWLHTEWHGMAAGFEDTALKALGAALEQCPGQGSRPSPLPTWANHRWQHAQVPGSEHA
LLLFCPLPAAKEAAGRLLAQLLQGPVYQRLRVDLQLGYAVFSAFRQVEGVGGLLFGVQSP
HTDQAQVLDHLLNLLRHGVTLDPAARQALAGQFDEPAMANADVAEWAWQTHLATQADRLD
VLRRSILTTRQTDLDHLLSALLDPGSAWLCLANAAAPDTSWQGENR