Protein Info for PP_0377 in Pseudomonas putida KT2440

Annotation: coenzyme PQQ synthesis protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR03859: coenzyme PQQ biosynthesis protein PqqD" amino acids 9 to 88 (80 residues), 120.9 bits, see alignment E=7.7e-40 PF05402: PqqD" amino acids 25 to 88 (64 residues), 57.7 bits, see alignment E=5.9e-20

Best Hits

Swiss-Prot: 100% identical to PQQD1_PSEPK: PqqA binding protein 1 (pqqD1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 92% identity to pen:PSEEN0395)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QV7 at UniProt or InterPro

Protein Sequence (91 amino acids)

>PP_0377 coenzyme PQQ synthesis protein D (Pseudomonas putida KT2440)
MSFDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNDSASLIGGLIDGQRDVAAIISE
LEQQFPGVPEVADDIEQFMEVARAEHWIVLA