Protein Info for PP_0369 in Pseudomonas putida KT2440

Annotation: putative diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 195 to 235 (41 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 240 to 414 (175 residues), 113.1 bits, see alignment E=5.4e-37 PF00990: GGDEF" amino acids 242 to 410 (169 residues), 101.9 bits, see alignment E=1.6e-33

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_0395)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QW5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PP_0369 putative diguanylate cyclase (Pseudomonas putida KT2440)
MFRLNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPTLVLLLGGAYCAVYRRQ
RELFLMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCLLLPALFGLYGAWQERTHL
LQDLVARGAVLFAVGSVAVALQQSYPEALLTWLAEIRWPALHGHWMSLIQMVYPLFLGVF
ILLVVQYLRAPRPLHAAQLIGLLGIFWMLPQTFILPFTLNIMCSQVMLMIAAAVAHEAYQ
MAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDHFKKFNDTHGHDVGDQVLRLVASRL
SKVTGGGRAYRYGGEEFALVFAGKTAAECVPHVEAVREVIANYVMHLRDQHNRPQDDTAG
RQRRAGSAGGTVSVTISIGVAERQADHRNPEAVLKSADQALYSAKGAGRNCVMVHGRQSP
RGAVRTA