Protein Info for PP_0364 in Pseudomonas putida KT2440

Annotation: pimeloyl-[acp] methyl ester esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF12697: Abhydrolase_6" amino acids 5 to 231 (227 residues), 43.3 bits, see alignment E=7.1e-15 PF00561: Abhydrolase_1" amino acids 44 to 224 (181 residues), 42.5 bits, see alignment E=6.5e-15

Best Hits

Swiss-Prot: 35% identical to BIOH_VIBCH: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 100% identity to ppu:PP_0364)

Predicted SEED Role

"Biotin synthesis protein BioH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QX0 at UniProt or InterPro

Protein Sequence (243 amino acids)

>PP_0364 pimeloyl-[acp] methyl ester esterase (Pseudomonas putida KT2440)
MRNRLVLLPGWGLGTAALEPLAASLRAQDARLQVELMPLPELAHSDVQAWIDHLDRKLPN
DVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPSFLARPDWPHGMAEDTFGTFLDGCR
NHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPETDPLYLATGLEVLAKLDTREALQAYD
GPQLHLFAGSDALVPAEAAKALSELLPDVEVGMVEDSSHAFLLEYPQELAAGIKSFLHES
GDD