Protein Info for PP_0358 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details PF00892: EamA" amino acids 8 to 141 (134 residues), 60 bits, see alignment E=1.6e-20 TIGR00688: protein RarD" amino acids 8 to 260 (253 residues), 247.5 bits, see alignment E=7.6e-78

Best Hits

Swiss-Prot: 75% identical to Y485_PSEAE: Uncharacterized transporter PA0485 (PA0485) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to ppu:PP_0358)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QX6 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PP_0358 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MHAANPRRGYILGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVLWSALFGSLLLLVWKHP
GWWRELRNNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEASLGYYINPLINVLLGMLI
LGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALSFGFYGLIRKQAPVAALPGLV
VETWMLVPLALGWLLLHPTAMSAQGAFYTSSEALWLMAAGPVTLVPLVCFNAAARHLPYT
TLGFLQYLAPTLVLLQAVVLFDEHLSSSTLAAFMFIWAGLAIYSVDAWLNLRKRS