Protein Info for PP_0349 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 12 to 361 (350 residues), 207.4 bits, see alignment E=2.3e-65

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0349)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QY5 at UniProt or InterPro

Protein Sequence (370 amino acids)

>PP_0349 putative Membrane protein (Pseudomonas putida KT2440)
MKSPTIRRWSLIHTWSSLVCTLFLLLLAVTGLPLIFHHELEHLLGDAPELREMPAGTPHL
DLQQLVLKAEQHRPGEVMQYFGYDEDEPNGVVAITAATASTDPNLSHTFMLDARTGEAVA
MPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAIVSGTVLYAPFMRRLEFGTVR
HKKSRRLRWLDLHNLIGVVTLAWALTVSVTGVISALSDLVIAAWRNDSLAAMVAPYRDAP
PLVERAPATRLLDIAEQAAPGMRPDFIAFPGTRFSSEHHYAVFMNGATHLSSHLFTPVLI
DARTLEVTAVGDRPWYMDAMGLSQPLHFGDYGGRPMQILWALLDVLTIIVLGSGLYLWWS
KQRKPWEARA