Protein Info for PP_0337 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 896 PF13185: GAF_2" amino acids 192 to 330 (139 residues), 38.6 bits, see alignment E=5.5e-13 PF01590: GAF" amino acids 193 to 330 (138 residues), 58.4 bits, see alignment E=5.2e-19 TIGR00229: PAS domain S-box protein" amino acids 343 to 463 (121 residues), 49.8 bits, see alignment E=3.7e-17 PF13188: PAS_8" amino acids 344 to 398 (55 residues), 26.8 bits, see alignment 1.7e-09 PF00989: PAS" amino acids 345 to 454 (110 residues), 35 bits, see alignment E=5.6e-12 PF08448: PAS_4" amino acids 349 to 458 (110 residues), 31.4 bits, see alignment E=8.5e-11 PF13426: PAS_9" amino acids 355 to 456 (102 residues), 54 bits, see alignment E=7.9e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 464 to 625 (162 residues), 122.9 bits, see alignment E=1.1e-39 PF00990: GGDEF" amino acids 468 to 621 (154 residues), 132 bits, see alignment E=8e-42 PF00563: EAL" amino acids 642 to 877 (236 residues), 256.2 bits, see alignment E=1.2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0337)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QZ7 at UniProt or InterPro

Protein Sequence (896 amino acids)

>PP_0337 Sensory box protein (Pseudomonas putida KT2440)
MKSQPDAASRVAAEVVTQLPVPSRLGMLRFERLNEATWAMLYLDPACERQFGLKTGELCA
LIDAPYASLMEPEARYRLHDDIQLQLAQRGYYRVRYTLHTPSTSLRLLEAGEAYKQHNRQ
LLRGYLSVLDDQQEETGEPGASDLESRNNRLQLALQLNQRTQQEQLEHLERVRGQQDLIL
RLARHRYSAGNSLLEAAQLITQSACEIYKVDCASIWHLEDQRLEPIIAWYRDAQEHRQPE
AIDASRFPDYLDALHASRAIDAHNAGHDPRTRALAQSMRPENKAMLDASIRVDGQVIGVL
CLEQSGQPRAWQSDEIAFAGELADQFAQVITNHKRRAAASALHLFQRAVEQSASAFLLVN
RDGRVEYVNPSFTAITQYSTDEVQGRQLGELPALENLSELLFDSPSSLAMGNSWQGEFKS
RRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDVTQTKLAQQRIERLAYTDNLTNLGNRP
AFIRSLDERFARDGESSMCLLLVDIDNFKRINDSLGHQTGDKLLISLARRLRNSLHSGGI
LARFASNEFAVLLDDTSLEDGQGVAQQLLCTLDKPMFVDNQLINVTASVGLACAPLHGVD
PASLMKNAGLALHKAKANGKHQVQVFTEVLNAEASYKLFVENNLRRALTQNELDVFYQPK
LCLRSGRLLGLEALLRWNHPERGMIRPDQFISVAEETGLIIPIGKWVVRQACCMSQQLRK
AGLGNLHVAINLSPKQFSDPDLVASISTILKEEALPPHLLELELTEGLLLEASEDTHRQL
DELKALGLTLAMDDFGTGYSSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMA
HNLKLKVVAEGIETPEQLAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA