Protein Info for PP_0326 in Pseudomonas putida KT2440

Annotation: sarcosine oxidase subunit gamma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 TIGR01375: sarcosine oxidase, gamma subunit family" amino acids 52 to 203 (152 residues), 175.1 bits, see alignment E=4.5e-56 PF04268: SoxG" amino acids 53 to 203 (151 residues), 257.2 bits, see alignment E=5.3e-81 PF01571: GCV_T" amino acids 83 to 206 (124 residues), 44.2 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: K00305, sarcosine oxidase, subunit gamma [EC: 1.5.3.1] (inferred from 100% identity to ppu:PP_0326)

Predicted SEED Role

"Sarcosine oxidase gamma subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R08 at UniProt or InterPro

Protein Sequence (210 amino acids)

>PP_0326 sarcosine oxidase subunit gamma (Pseudomonas putida KT2440)
MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRERKFLGHLTLRGDGHNPE
FAAGVHKALGLELPVALTVVANKDMSLQWVGPDEWLLIVPGGQELAAEQKLRAALEGQHI
QVVNVSGGQSLLELRGPNVRDVLMKSTSYDVHPNNFPVGKAVGTVFAKSQLVIRRTAEDT
WELVIRRSFADYWWLWLQDASAEYGLSIEA