Protein Info for PP_0308 in Pseudomonas putida KT2440

Annotation: putative dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF01244: Peptidase_M19" amino acids 7 to 320 (314 residues), 308 bits, see alignment E=3.8e-96

Best Hits

KEGG orthology group: K01274, D-alanyl-D-alanine dipeptidase [EC: 3.4.13.-] (inferred from 99% identity to pen:PSEEN5178)

Predicted SEED Role

"Microsomal dipeptidase (EC 3.4.13.19)" in subsystem Pyrroloquinoline Quinone biosynthesis (EC 3.4.13.19)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.-, 3.4.13.19

Use Curated BLAST to search for 3.4.13.- or 3.4.13.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R26 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PP_0308 putative dipeptidase (Pseudomonas putida KT2440)
MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVWEGFKATVDNIASSQKL
IRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQIAYVDVFKQLGVGIVQMCY
NTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHVGSKTSEEVILESKKPVCYSH
CLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLAKGIDSTIDDYAEAIEYTMNIVG
EDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFGKIINPLGIRTVGEFPNLTETLLKR
GHSERVVRKIMGENWVNVLKDVWGE