Protein Info for PP_0272 in Pseudomonas putida KT2440

Annotation: Outer membrane ferric siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 765 PF07715: Plug" amino acids 81 to 182 (102 residues), 67.6 bits, see alignment E=1.3e-22 TIGR01783: TonB-dependent siderophore receptor" amino acids 84 to 765 (682 residues), 314 bits, see alignment E=1.2e-97 PF00593: TonB_dep_Rec_b-barrel" amino acids 302 to 734 (433 residues), 144.1 bits, see alignment E=1.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0272)

Predicted SEED Role

"Outer membrane receptor for ferric coprogen and ferric-rhodotorulic acid" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R62 at UniProt or InterPro

Protein Sequence (765 amino acids)

>PP_0272 Outer membrane ferric siderophore receptor (Pseudomonas putida KT2440)
MNPQSITPVFIPFSQSGNCLKPLAFCIAVAISGGAVAADGKPLELDATQIEDSAVLPADD
AGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIHTIEQALETAPGVTANKSE
VGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMDLYERIDIVRGANGLLGGTGD
PSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNLPLSEDGRLRSRFVMTQQDANSF
RDNQSERSRAALANFEFDLDDATTLGAGYQYEYNKVVGGGWGANIPIWYRDGSKTDLPRS
TNLVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLKAAQATTEALNHRGLAKVNSAGRGSYG
GYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSGPFQLFGRTHQAMVGYNDSRTVGWSPQYT
CTMVGDGMTSAPALGCQFRANNGFPVTDWHNGVDDDYDLIASRTGLHSKTTTRLQGMYAA
TRLSITDPLSVIVGVRTSNYSSVTRSVAGERSSQEENGIVTPYLGAVYDLNVNYSVYASY
TDIFTPQTSETSSGSKVEPIRGQSYETGIKGEWFDGRLNASAAYFRTKQENKAVLDGDLT
TPTGGSAYKAGSGQETDGIDLEVAGALTPNWNVYAGYTYLHFRRVDSDGRSDPSHLFKAS
TTYRLSGPLDRLTLGAGVTAQTNIRAISSPAGQPTNGVSNGATDVNWSGYAIWNAMAKYQ
LTDDTSVSLHANNLFDKHYYSQYGFYAGAIYGDPRNLSLTVSTAF