Protein Info for PP_0266 in Pseudomonas putida KT2440

Annotation: Agmatine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR03380: agmatine deiminase" amino acids 6 to 364 (359 residues), 578.9 bits, see alignment E=1.8e-178 PF04371: PAD_porph" amino acids 14 to 363 (350 residues), 420 bits, see alignment E=3.4e-130

Best Hits

Swiss-Prot: 100% identical to AGUA_PSEPK: Agmatine deiminase (aguA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K10536, agmatine deiminase [EC: 3.5.3.12] (inferred from 100% identity to ppu:PP_0266)

MetaCyc: 78% identical to agmatine deiminase subunit (Pseudomonas aeruginosa)
Agmatine deiminase. [EC: 3.5.3.12]

Predicted SEED Role

"Agmatine deiminase (EC 3.5.3.12)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R68 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PP_0266 Agmatine deiminase (Pseudomonas putida KT2440)
MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQAAHVTLAKAIARFEPV
TVAVSAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVINDHGEVRGVDWGFNAWGG
FDGGLYAPWNRDEELAAKVLEMERCQRYQTEGFVLEGGSIHVDGEGTVITTEECLLNRNR
NPHLSREQIEAVLRDHLAVDTVVWLPDGLYNDETDGHVDNFCCYVRPGEVLLAWTDDSND
PNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLFATAEECAGVDQVAGSQERDPSVRL
AGSYVNFLIVNGGIIAPSFDDPADAEARAILARIFPDHEVVMIPGRELLLGGGNIHCLTQ
QQPAPVKR