Protein Info for PP_0263 in Pseudomonas putida KT2440

Annotation: C4-dicarboxylate transport transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF06490: FleQ" amino acids 12 to 125 (114 residues), 25.8 bits, see alignment E=4.4e-09 PF00072: Response_reg" amino acids 13 to 122 (110 residues), 104.3 bits, see alignment E=1.8e-33 PF00158: Sigma54_activat" amino acids 152 to 318 (167 residues), 228.6 bits, see alignment E=1.5e-71 PF14532: Sigma54_activ_2" amino acids 153 to 323 (171 residues), 78.2 bits, see alignment E=2.9e-25 PF07724: AAA_2" amino acids 175 to 301 (127 residues), 33.1 bits, see alignment E=2.4e-11 PF07728: AAA_5" amino acids 175 to 294 (120 residues), 32.9 bits, see alignment E=2.4e-11 PF18024: HTH_50" amino acids 405 to 453 (49 residues), 32 bits, see alignment 3.1e-11 PF02954: HTH_8" amino acids 410 to 450 (41 residues), 28.6 bits, see alignment 3.8e-10

Best Hits

Swiss-Prot: 79% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to ppu:PP_0263)

Predicted SEED Role

"C4-dicarboxylate transport transcriptional regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R71 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PP_0263 C4-dicarboxylate transport transcriptional regulatory protein (Pseudomonas putida KT2440)
MTTETLIDSRAQVILVDDDPHLRQALSQTLDLAGLKVVALAEAQGLAERIEADWPGVVVS
DIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMRAGAYDFLEKPFATDALLD
SVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAMLRLREQIGALAGTRADVLILG
ETGAGKEVVARALHDLSSRSEGPFVAINAGALAESVVESELFGHEPGAFTGAQKRRIGKF
EFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERLGGNQLIPLDIRIIAATKEDLRQSA
DQGRFRADLYYRLNVAPLRIPPLRERGDDILVLFQHFADAASQRHGLSPHALQPAQRALL
LRHDWPGNVRELQNAAERFALGLELALDGQAPSAAAPAAPMLSGNLSEQVEQFERSLIAA
ELAQPHGSMRSLAEALGIPRKTLHDKLRKHGLNFDGGSGGHDDQEDNR