Protein Info for PP_0252 in Pseudomonas putida KT2440

Annotation: 33 kDa chaperonin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 50 to 65 (16 residues), see Phobius details PF01430: HSP33" amino acids 8 to 278 (271 residues), 267.8 bits, see alignment E=5.8e-84

Best Hits

Swiss-Prot: 100% identical to HSLO_PSEPK: 33 kDa chaperonin (hslO) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 100% identity to ppu:PP_0252)

Predicted SEED Role

"33 kDa chaperonin (Heat shock protein 33) (HSP33)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R81 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PP_0252 33 kDa chaperonin (Pseudomonas putida KT2440)
MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPVQVLLGELMAATALLVG
AMKFDGLLILQARSAGPIPLLMVECSSEREIRGMARYEADQIPAGATLSQLMPDGHLTLT
IDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWLNAQGGKARGLLLQQLPRDRQ
PDDEEREDSWQHVVALAKTLKPEEWTEGNETLLHRLYHEDAVRLFDIQPLRFNCSCSRER
SGNALVSLGEHDAKALVDECGGTVEIDCQFCNERYFFDASDVAQLFAGGGTDVASETRH