Protein Info for PP_0250 in Pseudomonas putida KT2440

Annotation: heat shock protein Hsp15 involved in ribosome recycling

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 PF01479: S4" amino acids 11 to 56 (46 residues), 40.3 bits, see alignment E=2.2e-14 PF28601: HSP15_C" amino acids 91 to 129 (39 residues), 55.4 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 55% identical to HSLR_ECO57: Heat shock protein 15 (hslR) from Escherichia coli O157:H7

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 100% identity to ppu:PP_0250)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R83 at UniProt or InterPro

Protein Sequence (133 amino acids)

>PP_0250 heat shock protein Hsp15 involved in ribosome recycling (Pseudomonas putida KT2440)
MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGERCKPGKEPRVGDEFVLR
TGFDERTVVVKALSVVRRGAPEAQALYEETEESVRRREQAAEMRKAGAMGVTTDGRPTKK
QRRQIHQLHGSYD