Protein Info for PP_0247 in Pseudomonas putida KT2440

Annotation: Osmolarity sensor protein EnvZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details PF00672: HAMP" amino acids 166 to 216 (51 residues), 34.9 bits, see alignment 2.4e-12 PF00512: HisKA" amino acids 222 to 274 (53 residues), 39.7 bits, see alignment 6.1e-14 PF02518: HATPase_c" amino acids 321 to 428 (108 residues), 83.8 bits, see alignment E=1.7e-27

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to ppf:Pput_0262)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R86 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PP_0247 Osmolarity sensor protein EnvZ (Pseudomonas putida KT2440)
MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQYSHGVALTLRAYWAA
DEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAELGDDTEVRLRIHAPPALW
VNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASAWIFVRQLNQPLKRLVFA
ARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQAGRERELMLAGVSHDLRTPLTRL
RLSLSLLNSDNELSDDMVRDIEDMDAILDQFLAFIRDGRDEPVEEVDLADLVREVVAPYN
QPEERVRLCLEPIPPFPLRRVSLKRMLGNLIGNALHHAGKGVEVAAYVSGDESAPYVVLS
VLDRGTGIDESELETIFNPFIRGDRARGGKGTGLGLAIVKRIAAQHGGNVELRNRSGGGI
EARVRLPLGLLLPRNAV