Protein Info for PP_0246 in Pseudomonas putida KT2440

Annotation: two-component system DNA-binding response transcriptional dual regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00072: Response_reg" amino acids 13 to 123 (111 residues), 106.9 bits, see alignment E=6.6e-35 PF00486: Trans_reg_C" amino acids 166 to 238 (73 residues), 78.1 bits, see alignment E=4.3e-26

Best Hits

Swiss-Prot: 68% identical to OMPR_SALTI: Transcriptional regulatory protein OmpR (ompR) from Salmonella typhi

KEGG orthology group: K07659, two-component system, OmpR family, phosphate regulon response regulator OmpR (inferred from 100% identity to ppg:PputGB1_0271)

Predicted SEED Role

"Two-component system response regulator OmpR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R87 at UniProt or InterPro

Protein Sequence (246 amino acids)

>PP_0246 two-component system DNA-binding response transcriptional dual regulator (Pseudomonas putida KT2440)
MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTEQMDRLLQREVFNLVVL
DLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLELGADDYLGKPFNPDELMA
RVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKRGNEVHMLTTGEFAVLKALVM
HAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDPSKPRYIQTVWGVGYVFVP
DGNAGK