Protein Info for PP_0236 in Pseudomonas putida KT2440

Annotation: NAD(P)H-dependent FMN reductase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF03358: FMN_red" amino acids 1 to 142 (142 residues), 119.1 bits, see alignment E=1.3e-38 TIGR03567: FMN reductase" amino acids 3 to 171 (169 residues), 247.4 bits, see alignment E=3.6e-78 PF02525: Flavodoxin_2" amino acids 3 to 114 (112 residues), 27.8 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 100% identical to SSUE_PSEPK: FMN reductase (NADPH) (ssuE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 100% identity to ppu:PP_0236)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88R97 at UniProt or InterPro

Protein Sequence (197 amino acids)

>PP_0236 NAD(P)H-dependent FMN reductase subunit (Pseudomonas putida KT2440)
MLVVSIGGSPSLRSRSGVLLERSRQWLQDRGVEVVTFQVRDFPAEDLLHARFDSPHVQHF
QQLVAQADGLIVSTPVYKASFSGALKTLLDLLPERALAHKIVLPIATGGSIAHMLAVDYA
LKPVLSALKAQETLQGIFADDSQVAYAEGTKPAQLVQALEERLHDSLETFHVALARRPRP
VAPGVLNERLISARWSI