Protein Info for PP_0229 in Pseudomonas putida KT2440

Annotation: choline/carnitine/betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 352 to 371 (20 residues), see Phobius details amino acids 411 to 435 (25 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details amino acids 480 to 499 (20 residues), see Phobius details PF02028: BCCT" amino acids 18 to 506 (489 residues), 595.3 bits, see alignment E=3.9e-183 TIGR00842: transporter, betaine/carnitine/choline transporter (BCCT) family" amino acids 57 to 503 (447 residues), 509.3 bits, see alignment E=4.4e-157

Best Hits

Swiss-Prot: 44% identical to BETT_ECOLI: High-affinity choline transport protein (betT) from Escherichia coli (strain K12)

KEGG orthology group: K02168, high-affinity choline transport protein (inferred from 100% identity to ppg:PputGB1_0253)

MetaCyc: 44% identical to choline:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-99

Predicted SEED Role

"High-affinity choline uptake protein BetT" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RA4 at UniProt or InterPro

Protein Sequence (667 amino acids)

>PP_0229 choline/carnitine/betaine transporter (Pseudomonas putida KT2440)
MSAPNPSLANGKIRMNPPVFYFAASFILIFGLVVISNPQAAGDWLLAAQNWAANTVGWYY
MLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFAAGISITLFFFCVSEPL
THMLQPPQGEAGTVEAGRQAMQILFLHWGLHGWGVFAFVGMALAYFAYRHNLPLALRSAL
YPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNAGLDYLFGISHSQWVQVILI
TLMMGAAVAVAVAGVEKGVRVMSDINLFLACALLLFVLFAGPTQHLFNTLIQNLGDYLGA
LPRKSFDVYAYGENRGWLGGWTVFYWAWWIAWAPFVGLFIARISRGRTIREFVFGVLLIP
LGFTLAWMSIFGNSALDQVINHGMTALGQSALDNPSMSLYLLLETYPWSKAVIATTVFIS
FVFFVTSADSGTVVLSTLSAKGGDADEDGPNWLRIFWGAMTALITSALLFAGSIDSLKSA
VVLTSLPFSLILLCMMWGLHKAFYLESQRQIAQMHSLAPFAQSRRGRGGWRQRLSQAVHF
PSRDEVYRFMDDVVRPAIADVREVFEQKGLVLITQDDPSHDNVSLKIGHGEEQPFIYQVQ
MRGYFTPSFALGGLGTQELKNRRYYRAEVHLSEGSQNYDLVGYSKEQIINDILDQYERHM
QYLHLVR