Protein Info for PP_0208 in Pseudomonas putida KT2440

Annotation: putative Nitrate ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 67 to 89 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 169 to 212 (44 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 253 (173 residues), 90.5 bits, see alignment E=5.7e-30

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ppu:PP_0208)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RC4 at UniProt or InterPro

Protein Sequence (260 amino acids)

>PP_0208 putative Nitrate ABC transporter, permease protein (Pseudomonas putida KT2440)
MTRNLKRWPVRLASLLACLLFWQVAANVKMDLGLLTFTYVPTPKAVLDAAWQLLTSSTLL
AHLGSSLARVFAGYATAALVGVALGLLIGRSKWAEDTLLPPLEVLRPIPAVAWIPLAILM
FPSSELSMVFITFTGALFPILLNTVHGVEAVDPRLVASARSLGAGRWAILREVVLPGALP
SIVTGLAIGMGTSWFCLVTAEMISGQFGIGYYTWESYTLQNYPDIVVGMLLIGVLGMGSS
ALVKRLGALATPWYRTRRAS