Protein Info for PP_0206 in Pseudomonas putida KT2440

Annotation: Ferredoxin, 4Fe-4S

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 81 PF13237: Fer4_10" amino acids 16 to 68 (53 residues), 25.6 bits, see alignment E=2.3e-09 PF12837: Fer4_6" amino acids 16 to 40 (25 residues), 24.2 bits, see alignment E=6e-09 PF12838: Fer4_7" amino acids 23 to 71 (49 residues), 35.4 bits, see alignment E=3.1e-12 PF13187: Fer4_9" amino acids 28 to 71 (44 residues), 28.3 bits, see alignment E=3.7e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to pen:PSEEN0176)

Predicted SEED Role

"Adenylylsulfate reductase beta-subunit (EC 1.8.99.2)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.99.2

Use Curated BLAST to search for 1.8.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RC6 at UniProt or InterPro

Protein Sequence (81 amino acids)

>PP_0206 Ferredoxin, 4Fe-4S (Pseudomonas putida KT2440)
MAYQPQEIFFRSSAPVTIDVDKCIAEKGCTVCVEVCPMDLLAINPATQKAYMAFDECWYC
MPCEKDCPTGAVKVDIPYLLR