Protein Info for PP_0206 in Pseudomonas putida KT2440
Annotation: Ferredoxin, 4Fe-4S
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 98% identity to pen:PSEEN0176)Predicted SEED Role
"Adenylylsulfate reductase beta-subunit (EC 1.8.99.2)" in subsystem Anaerobic respiratory reductases (EC 1.8.99.2)
MetaCyc Pathways
- sulfite oxidation III (2/3 steps found)
- sulfite oxidation II (1/3 steps found)
- dissimilatory sulfate reduction I (to hydrogen sufide)) (2/5 steps found)
- superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
- superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (2/6 steps found)
- superpathway of sulfide oxidation (phototrophic sulfur bacteria) (6/12 steps found)
- superpathway of sulfur oxidation (Acidianus ambivalens) (1/9 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.8.99.2
Use Curated BLAST to search for 1.8.99.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88RC6 at UniProt or InterPro
Protein Sequence (81 amino acids)
>PP_0206 Ferredoxin, 4Fe-4S (Pseudomonas putida KT2440) MAYQPQEIFFRSSAPVTIDVDKCIAEKGCTVCVEVCPMDLLAINPATQKAYMAFDECWYC MPCEKDCPTGAVKVDIPYLLR