Protein Info for PP_0186 in Pseudomonas putida KT2440

Annotation: Porphobilinogen deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00212: hydroxymethylbilane synthase" amino acids 6 to 297 (292 residues), 361.6 bits, see alignment E=1.3e-112 PF01379: Porphobil_deam" amino acids 6 to 213 (208 residues), 290.5 bits, see alignment E=7e-91 PF03900: Porphobil_deamC" amino acids 227 to 295 (69 residues), 70.5 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 100% identical to HEM3_PSEPK: Porphobilinogen deaminase (hemC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 100% identity to ppf:Pput_0208)

MetaCyc: 67% identical to hydroxymethylbilane synthase (Escherichia coli K-12 substr. MG1655)
Hydroxymethylbilane synthase. [EC: 2.5.1.61]

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RE5 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_0186 Porphobilinogen deaminase (Pseudomonas putida KT2440)
MSTREIRIATRKSALALWQAEYVKARLEQAHTGLQVTLVPMVSRGDKLLDAPLAKIGGKG
LFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEALP
AGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFE
DRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVIAERALNKRLNG
GCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRAAAEALGVQVAEDLLGQGAE
AILKEVYGEAGHP