Protein Info for PP_0170 in Pseudomonas putida KT2440

Annotation: ABC transporter, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF09084: NMT1" amino acids 62 to 266 (205 residues), 23.5 bits, see alignment E=4.7e-09 PF13379: NMT1_2" amino acids 65 to 271 (207 residues), 40 bits, see alignment E=4.1e-14

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_0191)

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RG0 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_0170 ABC transporter, periplasmic binding protein (Pseudomonas putida KT2440)
MRKSISRLAASIGLGASLVVGSLAAPAVAQAEGKIRIAEQFGIVYLLLNVVRDQHLIEKH
GKEQGIDIEVDWAQLSGGSAVNDALLSGSVDIAGAGVGPLLTVWDRTKGRQNVKAVASLG
NFPYYLVSSNPNVKTIADISDKDRIAVPAVGVSVQSRFLQYAAAQQWGDKEYNRLDKYTL
AVPHPDATAALLAGGTELNGHFSNPPFQDQVLANKDVHVVLNSYDLLGPNSPTLLFATEK
FRKDNPKTYKAFVDALAEAADFAQKDKAAAADTYIRVTKAKIDRDALIKLIDNPQYEFTV
TPKNTYKLADFLYRVGAIKHKPQSWKDYFFQDERPLQGS