Protein Info for PP_0142 in Pseudomonas putida KT2440

Annotation: putative ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 132 to 150 (19 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 264 to 294 (31 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 125 to 373 (249 residues), 237.9 bits, see alignment E=7.5e-75 PF02405: MlaE" amino acids 161 to 370 (210 residues), 241.6 bits, see alignment E=3.5e-76

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to ppu:PP_0142)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RI7 at UniProt or InterPro

Protein Sequence (377 amino acids)

>PP_0142 putative ABC transporter, permease protein (Pseudomonas putida KT2440)
MEPMTNPSATLDTSSQPACLRITGDWTLAHYANLKRESERLRSHCPADTVADLSQLGRLD
TAGASLLAELLGSERLSHCTHALPEASQALLKNVYCSVQDYCIPVKEPERNVLLLLLERI
GRAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPVVAHIEQTGLDAAPIVALLTF
LVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMK
ANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAM
FLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFV
VIVLDAVAALFFMEMGW