Protein Info for PP_0114 in Pseudomonas putida KT2440

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00005: ABC_tran" amino acids 21 to 170 (150 residues), 133 bits, see alignment E=1.7e-42 PF09383: NIL" amino acids 263 to 333 (71 residues), 63.7 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 100% identical to METN1_PSEPK: Methionine import ATP-binding protein MetN 1 (metN1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 100% identity to ppf:Pput_0131)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RL5 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PP_0114 methionine ABC transporter ATP-binding protein (Pseudomonas putida KT2440)
MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGKSTMLRLINRLEEPSGG
TIIVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADNVALPLALAGELSRSEIDK
RVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNPKILLCDEATSALDPQTTASV
LQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGQIVEQGSVAEVFLHPQHPTTKR
FVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYAPLLGTVARETGVDYSILAGRIDRI
KDVPYGQLTLALIGGDMEAAFARFKAADVHMEVLR