Protein Info for PP_0109 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 77 to 96 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 7 to 317 (311 residues), 268.6 bits, see alignment E=3.6e-84

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to ppu:PP_0109)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RM0 at UniProt or InterPro

Protein Sequence (359 amino acids)

>PP_0109 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGFISVPKTDVQLAHAELH
FPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARDGQPYRLPMLLLGVVLAQA
AFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRAFAPLPKLPLSLRRIAALALL
VVIGQIALGGWVSANYAAVACIDLPTCHGQWWPAADFSNGFHLTQHVGPNYLGGQLDSDA
RTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLSRLVLLALALQVGLGISNVVFHLPLA
VAVAHNAGGAMLLLSMVLVNYRIRVVDKVRVGVGHGWRLRPVVGVGISHHMRNDSWRRF