Protein Info for PP_0101 in Pseudomonas putida KT2440

Annotation: putative sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details amino acids 372 to 399 (28 residues), see Phobius details PF00916: Sulfate_transp" amino acids 8 to 377 (370 residues), 202.5 bits, see alignment E=4.7e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0101)

Predicted SEED Role

"Sulfate transporter family protein in cluster with carbonic anhydrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RM8 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PP_0101 putative sulfate transporter (Pseudomonas putida KT2440)
MKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLITGIIGGIVVGFLAGSPLQVSG
PAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGRLRLGCWFRVTAPAVVYGMLAGIG
VLIVLSQVHVMFDTAPQPSGLQNLLEFPATLSAALPQESTGAGWMAGALGLGTIAIMWGW
ERLRPQRLRFVPGALLGVASMTAISMWLALPVNRVQVPADLSEAIDWLRPEDLLQLADPT
LLVAAFALAFIASAETLLSAAAVDRMHSGQRSDFDRELSAQGIGNMLCGVLGALPMTGVI
VRSSANVQAGAQTRASAIFHGLWLLAFVVALSSVLQQIPVASLAGVLVFTGVKLVDFKAF
RGLGRYGRMPMFTYAATALAIIFTDLLTGVLLGFALTLLKLAFKAARLKINLVSLAKDGH
MELRLSGAATFLKVPALTQVLDTVPAGTTLHVPLGNLSYIDHSCLELLEDWSRSNSANGS
RLLIEQRRLKRRIEGRLRTTAGVGA