Protein Info for PP_0069 in Pseudomonas putida KT2440

Annotation: putative Rossmann fold nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 231 to 250 (20 residues), see Phobius details PF21102: DprA_N" amino acids 15 to 48 (34 residues), 23.5 bits, see alignment 5.2e-09 TIGR00732: DNA protecting protein DprA" amino acids 79 to 297 (219 residues), 259.2 bits, see alignment E=1.2e-81 PF02481: DNA_processg_A" amino acids 88 to 297 (210 residues), 253.7 bits, see alignment E=1.5e-79 PF17782: WHD_DprA" amino acids 306 to 358 (53 residues), 30.6 bits, see alignment 4.4e-11

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to ppu:PP_0069)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RR0 at UniProt or InterPro

Protein Sequence (365 amino acids)

>PP_0069 putative Rossmann fold nucleotide-binding protein (Pseudomonas putida KT2440)
MPSHHSSPCPPAELEARLRLHRLPDAGLRRFRTLLEAFGSASSALSAPASAWRALGIPQA
TIDARRSAEVRDGALAAMAWLERPGQHLLMWDGPGYPALLAEIDDAPPLLFVAGEPALLD
RPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAVGVDGAAHRAALQAGGGTIAV
LGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPLDAGPLPGNFPRRNRIISGLSLGVLVVE
ASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGCHQLIRDGALLVETVEQILESLQGW
QNLPPAVVDKFDHPLLALLHAAPQTSESLAHCSEQPLADVLAQLTELELEGRVSNEAGRW
FARAG