Protein Info for PP_0064 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF14559: TPR_19" amino acids 27 to 72 (46 residues), 29.9 bits, see alignment E=8.8e-11

Best Hits

Swiss-Prot: 72% identical to Y015_PSEAE: TPR repeat-containing protein PA0015 (PA0015) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0080)

Predicted SEED Role

"Chaperone protein YscY (Yop proteins translocation protein Y)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RR5 at UniProt or InterPro

Protein Sequence (104 amino acids)

>PP_0064 conserved protein of unknown function (Pseudomonas putida KT2440)
MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVEQDPKYSAAWKLLGKAY
QLQGELAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKTSA