Protein Info for PP_0026 in Pseudomonas putida KT2440

Annotation: putative cobalt/cadmium/zinc exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 106 (25 residues), see Phobius details amino acids 118 to 142 (25 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 290 (274 residues), 291.5 bits, see alignment E=3.2e-91 PF01545: Cation_efflux" amino acids 20 to 211 (192 residues), 158 bits, see alignment E=2.7e-50 PF16916: ZT_dimer" amino acids 215 to 289 (75 residues), 55.7 bits, see alignment E=4e-19

Best Hits

Swiss-Prot: 61% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 100% identity to ppg:PputGB1_0040)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88RV3 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PP_0026 putative cobalt/cadmium/zinc exporter (Pseudomonas putida KT2440)
MGSNHDHGSAAVREGHQKKLIMALGLTGSFMIAEVIGAWITGSLALLSDASHMFTDTAAL
AISLIALQIAKRPADQKRTFGYARLEILASTFNAVLLFLVAMYILYEAYQRFFMPAEIAT
GAMMWIAIAGLIINLISMRLLASASNESLNVKGAYLEVWSDMLGSLGVIIAALIIRFTGW
TWVDTIVAVAIGLWVLPRTWQLLRESLGILMEGVPRGLDVTAIEATILGVDGVTDVHDLH
VWAVSSGSNVMTSHVVVRDSADGDAVLAAVVDAVSDAFEIHHCTIQIERAAFHESVPSPS
H