Protein Info for PP_0010 in Pseudomonas putida KT2440

Annotation: chromosomal replication initiator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 PF11638: DnaA_N" amino acids 4 to 63 (60 residues), 73.6 bits, see alignment E=2.1e-24 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 6 to 504 (499 residues), 629.8 bits, see alignment E=1.4e-193 PF00308: Bac_DnaA" amino acids 171 to 331 (161 residues), 253.2 bits, see alignment E=3.1e-79 PF01695: IstB_IS21" amino acids 207 to 309 (103 residues), 25.1 bits, see alignment E=3e-09 PF00004: AAA" amino acids 208 to 318 (111 residues), 25.6 bits, see alignment E=3.6e-09 PF08299: Bac_DnaA_C" amino acids 415 to 483 (69 residues), 110.1 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 100% identical to DNAA_PSEPU: Chromosomal replication initiator protein DnaA (dnaA) from Pseudomonas putida

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to ppu:PP_0010)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A116 at UniProt or InterPro

Protein Sequence (506 amino acids)

>PP_0010 chromosomal replication initiator protein (Pseudomonas putida KT2440)
MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRFVLDWVNEKYLGRLL
ELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASLAQTQAHKTAPAAAVEPVA
VAAAEPVLVETSSRDSFDAMAEPAAAPPSGGGRAEQRTVQVEGALKHTSYLNRTFTFDTF
VEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLKKNPNAKVVYL
HSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARKERSQEEFFHTFNALLEGG
QQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQAKVELPHDA
AFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDKLVSVDNIQR
TVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNHSLPEIGDMFGGRDHTTVLHAC
RKINELKESDADIREDYKNLLRTLTT