Protein Info for PFR28_05166 in Pseudomonas sp. RS175

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 638 to 661 (24 residues), see Phobius details PF05170: AsmA" amino acids 1 to 575 (575 residues), 490.5 bits, see alignment E=9.9e-151 PF13502: AsmA_2" amino acids 432 to 605 (174 residues), 56.5 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 52% identical to YHJG_ECOLI: AsmA family protein YhjG (yhjG) from Escherichia coli (strain K12)

KEGG orthology group: K07290, hypothetical protein (inferred from 92% identity to pba:PSEBR_a583)

Predicted SEED Role

"exported protein, conserved"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (691 amino acids)

>PFR28_05166 hypothetical protein (Pseudomonas sp. RS175)
MTRTSKILAWSFASLVVLLAALVLVIAFFDWNRIKPALNAKVSEELHRPFAINGNLAVVW
QREQQEGGWRGWVPWPHVVAEDLTLGNPDWSKSPQMATLERVELRISPLALLARRVAIPR
IDLTGPNANLQRLADGRANWTFQFDPKDPDAEPSSWTVDIGAIGFDKGHVTLDDQTLKTR
LDLVIELLGKPVPFSDIVGEKTASKARDQGALPQDYAFAFKVDGQYHGQGLSGSGKVGGL
LALQDATQPFPLQAQAKIAETRIELAGTLTDPKNLGALDLRLKLAGSNLAHLYPLTGVTL
PDSPPYATDGHLVAKLHEPGGALFRYEAFNGRIGDSDIHGDLAYAAGEPRPKLSGALVSD
QLLFSDLAPLIGADSNTEQKARGAASKQPSDKVLPVEEFRTERWSAMDADVEFTGKRIVH
SEQLPFNDLYTHLVLTDGQLSLEPLRFGVAGGRLDAQIRLNGHTQPLEGRARLTARGFKL
KQLFPGFEPMKTSFGELNGDADIAGRGNSVAALLGTSNGTLKMLINDGAISRELMELAGL
NVGNYVVGKIFGDKEVKINCAAADFDIKSGLATTRLFVFDTENAIIYVDGTANMATEQLD
LTVTPESKGWRLISLRSPLYVRGPFAKPSAGVKAVPLMLRGAGMVALGVIAAPAAGLLAL
VAPSGGEPNQCAPLLEQMKAGKAPVTVKPTR