Protein Info for PFR28_04858 in Pseudomonas sp. RS175

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 196 (190 residues), 180.2 bits, E=4.9e-57
• PF08659: KR
  • amino acids 10 to 169 (160 residues), 57.7 bits, E=2.3e-19
• PF13561: adh_short_C2
  • amino acids 13 to 245 (233 residues), 208.3 bits, E=2e-65

Best Hits

Swiss-Prot: 40% identical to AFLM_ASPPU: Versicolorin reductase 1 (aflM) from Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 89% identity to pba:PSEBR_a271)

MetaCyc: 43% identical to lyngbyatoxin A monooxygenase (Moorena producens)
1.14.13.-; 1.14.13.-

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• stearate biosynthesis IV (4/6 steps found)
• lyngbyatoxin biosynthesis (2/5 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Protein Sequence (246 amino acids)

>PFR28_04858 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Pseudomonas sp. RS175)
MIRQTSKVAIVTGASRGIGAQVARQLAEDGFAVAINYANNAIEASKLVVQLRQAGHQALA
IKADVSCAADVRRMFDETETHLGKVDLLVNNAGILQVLPLAQHSDELFEQTFAINTRGTF
NTLREAATRLNDGGRIVNFSSSTVGLNLPGYSVYIASKAAVESLTQVFAKELRGRQITVN
AIAPGPVATELFMHGKSEEQVQHYAKMPPLERLGQPEDIARIVSFLASPAADWVNGQVLR
ANGGLV